General Information

  • ID:  hor006393
  • Uniprot ID:  P09475
  • Protein name:  Carboxy-terminal peptide
  • Gene name:  NA
  • Organism:  Lophius americanus (American angler) (Anglerfish)
  • Family:  NPY family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Lophius (genus), Lophiidae (family), Lophioidei (suborder), Lophiiformes (order), Eupercaria, Percomorphaceae, Euacanthomorphacea, Acanthomorphata, Ctenosquamata, Eurypterygia, Neoteleostei, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  SSPEEAVAWLLFKADPSQDIEPRLDDDNAW
  • Length:  30
  • Propeptide:  YPPKPETPGSNASPEDWASYQAAVRHYVNLITRQRYGXXSSPEEAVAWLLFKADPSQDIEPRLDDDNAW
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor006393_AF2.pdbhor006393_ESM.pdb

Physical Information

Mass: 393314 Formula: C152H224N38O52
Absent amino acids: CGHMTY Common amino acids: D
pI: 3.63 Basic residues: 2
Polar residues: 4 Hydrophobic residues: 12
Hydrophobicity: -74.33 Boman Index: -6828
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 75
Instability Index: 8148 Extinction Coefficient cystines: 11000
Absorbance 280nm: 379.31

Literature

  • PubMed ID:  3838934
  • Title:  A nonamidated peptide homologous to porcine peptide YY and neuropeptide YY.
  • PubMed ID:  3520508
  • Title:  Anglerfish islets contain NPY immunoreactive nerves and produce the NPY analog aPY.
  • PubMed ID:  3522578
  • Title:  Isolation and structure of the second of two major peptide products from the precursor to an anglerfish peptide homologous to neuropeptide Y.